Популярное

Музыка Кино и Анимация Автомобили Животные Спорт Путешествия Игры Юмор

Интересные видео

2025 Сериалы Трейлеры Новости Как сделать Видеоуроки Diy своими руками

Топ запросов

смотреть а4 schoolboy runaway турецкий сериал смотреть мультфильмы эдисон
dTub
Скачать

Vanila Ice Cream Using GMS & CMC Powder | सिर्फ 2 कप दूध से बनाये 2 Litre आइसक्रीम | 2 in1 Flavour

Автор: Rupali Food Corner

Загружено: 2024-06-10

Просмотров: 33375

Описание:

Vanila Ice Cream Using GMS & CMC Powder | सिर्फ 2 कप दूध से बनाये 2 Litre आइसक्रीम | 2 in1Flavour



vanila ice cream using gms & cms
ice cream using gms and cmc
vanilla ice cream using ice cream maker
cms and gms powder ice cream
gms cmc ice cream recipe
gms and cmc powder for ice cream
ice cream base recipe with gms and cmc powder
gms for ice cream
gms and cmc powder ice cream recipe
gms in ice cream
gm vanilla ice cream problem
gms used in ice cream
vanilla ice cream ice cream machine

*********************************************

Ingredients-

Milk - 1/2 litre / 2 cup
Corn flour - 1+1/2 tbsp
CMC powder - 1/4 tsp
GMS powder - 1+1/2 tsp
Sugar - 6 tbsp
Vanilla essence - 1/2 tsp
Cocoa powder - 2 tbsp
Condensed milk - 2 tbsp
Whipping cream - 1 cup

*********************************************

ice cream,ice cream recipe,vanilla ice cream,vanilla ice cream recipe,how to make ice cream,homemade vanilla ice cream recipe,homemade ice cream,how to make ice cream at home,how to make vanilla ice cream,vanilla ice cream recipe in hindi,ice cream recipe in hindi,easy ice cream recipe,homemade ice cream recipe,chocolate ice cream recipe,strawberry ice cream,easy ice cream,chocolate ice cream,gms cmc ice cream recipe,how to make ice cream base
vanilla ice cream,vanilla ice cream recipe,ice cream,how to make vanilla ice cream,homemade vanilla ice cream,ice cream recipe,homemade vanilla ice cream recipe,best vanilla ice cream,homemade ice cream,easy vanilla ice cream,how to make ice cream,recipe for vanilla ice cream,how to make ice cream at home,vanilla ice cream at home,vanilla ice cream trailer,vanilla homemade ice cream,vanilla ice cream recipe in hindi,vanilla ice cream without machine, summer special ice cream recipe,


#vanilaicecream #rupalifoodcorner
#vanilaicecreamusinggmscmcpowder
#howtomakevanilaicecream
#vanilaicecreambaseusinggmscmcpowder
#icecreamrecipe #homemadevanilaicecream
#chocolateicecreamrecipe #easyicecreamrecipe
#icecreambase #2in1flavouricecream
#marketstylevanilaicecreamkirecipe
#indiandessert #summerspecialrecipe
#chocolateicecream #indiansweet #dessertrecipes


Thanks For Watching
Please Like, share & Subscribe

Vanila Ice Cream Using GMS & CMC Powder | सिर्फ 2 कप दूध से बनाये 2 Litre आइसक्रीम | 2 in1 Flavour

Поделиться в:

Доступные форматы для скачивания:

Скачать видео mp4

  • Информация по загрузке:

Скачать аудио mp3

Похожие видео

1/2 litter milk से बनाए 2 litter से ज्यादा  Ice Cream Base using GMS & CMC Powder | Mango Ice Cream

1/2 litter milk से बनाए 2 litter से ज्यादा Ice Cream Base using GMS & CMC Powder | Mango Ice Cream

Kacha Kele ki Machali Style Sabji | Raw Banana Fish Curry | मछली की तरह बनाये कच्चे केले की सब्जी

Kacha Kele ki Machali Style Sabji | Raw Banana Fish Curry | मछली की तरह बनाये कच्चे केले की सब्जी

Ice cream base with GMS and CMC powder/इसको सिख कर कोई भी आइस्क्रीम बनाए बाज़ार की तरह/icecream base

Ice cream base with GMS and CMC powder/इसको सिख कर कोई भी आइस्क्रीम बनाए बाज़ार की तरह/icecream base

Homemade Butterscotch Ice-cream with Gms and Cmc powder । Butterscotch ice-cream recipe

Homemade Butterscotch Ice-cream with Gms and Cmc powder । Butterscotch ice-cream recipe

Butterscotch Ice Cream Recipe l Enjoy the coolness of summer with butterscotch ice cream 🍨

Butterscotch Ice Cream Recipe l Enjoy the coolness of summer with butterscotch ice cream 🍨

½ लीटर दूध से 2½ लीटर आईसक्रीम~Ice Cream Using G.M.S & C.M.C Powder| 100% soft Professional IceCream

½ लीटर दूध से 2½ लीटर आईसक्रीम~Ice Cream Using G.M.S & C.M.C Powder| 100% soft Professional IceCream

Pan Ice cream | घर पर बनाए मार्केट से बेहतर रिफ्रेशिंग पान आइसक्रीम | Homemade Pan Icecream

Pan Ice cream | घर पर बनाए मार्केट से बेहतर रिफ्रेशिंग पान आइसक्रीम | Homemade Pan Icecream

Homemade Milk Ice Cream With Gms & Cmc Powder By Cooking Genius Maryam | Strawberry & Kulfa Flavours

Homemade Milk Ice Cream With Gms & Cmc Powder By Cooking Genius Maryam | Strawberry & Kulfa Flavours

Home made Vanilla Ice Cream Using G.M.S & C.M.C Powder | How to make Vanilla Ice Cream Base |Vanilla

Home made Vanilla Ice Cream Using G.M.S & C.M.C Powder | How to make Vanilla Ice Cream Base |Vanilla

GELATO MASTERCLASS: Make the best Italian ice cream AT HOME!

GELATO MASTERCLASS: Make the best Italian ice cream AT HOME!

Смешайте ЛАК с КЛЕЕМ ПВА и откройте СЕКРЕТ, о котором мало кто знает! Удивительно!

Смешайте ЛАК с КЛЕЕМ ПВА и откройте СЕКРЕТ, о котором мало кто знает! Удивительно!

Instant Ragi Idli | Healthy Weight loss Breakfast | Gluten- Free - Rich in Calcium, Iron & Protein

Instant Ragi Idli | Healthy Weight loss Breakfast | Gluten- Free - Rich in Calcium, Iron & Protein

Homemade ice cream Comercial stablizer recipe by pyari ruqaya ka kitchen

Homemade ice cream Comercial stablizer recipe by pyari ruqaya ka kitchen

CMC vs GMS | सी ऍम सी और जी ऍम एस क्या हैं? Tylose Powder | Everyday Life #90

CMC vs GMS | सी ऍम सी और जी ऍम एस क्या हैं? Tylose Powder | Everyday Life #90

सिर्फ दूध से वनीला आइसक्रीम बनाने का ऐसा नया तरीका की गारंटी से क्रीमी सॉफ्ट बनेगी Vanilla Ice Cream

सिर्फ दूध से वनीला आइसक्रीम बनाने का ऐसा नया तरीका की गारंटी से क्रीमी सॉफ्ट बनेगी Vanilla Ice Cream

Make 2kg Ice Cream with JUST 1 Liter of Milk | Easy Vanilla Custard and Caramel Ice Cream Recipe

Make 2kg Ice Cream with JUST 1 Liter of Milk | Easy Vanilla Custard and Caramel Ice Cream Recipe

Ice Cream Class Day-18~ ½ लीटर दूध से 2½ लीटर आईसक्रीम ~Ice Cream Using G.M.S & C.M.C Powder

Ice Cream Class Day-18~ ½ लीटर दूध से 2½ लीटर आईसक्रीम ~Ice Cream Using G.M.S & C.M.C Powder

How to Make Ice-cream at Home | How to Make Ice-cream Premix और 50 से भी ज्यादा फ्लेवर में आइसक्रीम

How to Make Ice-cream at Home | How to Make Ice-cream Premix और 50 से भी ज्यादा फ्लेवर में आइसक्रीम

Homemade Ice cream Premix | Chocolate Ice Cream Premix | Vanilla Ice cream Premix आइसक्रीम प्रीमिक्स

Homemade Ice cream Premix | Chocolate Ice Cream Premix | Vanilla Ice cream Premix आइसक्रीम प्रीमिक्स

2 litre ice cream from 1/2 litre milk~ice cream base recipe using GMS and CMC powder

2 litre ice cream from 1/2 litre milk~ice cream base recipe using GMS and CMC powder

© 2025 dtub. Все права защищены.



  • Контакты
  • О нас
  • Политика конфиденциальности



Контакты для правообладателей: [email protected]