Популярное

Музыка Кино и Анимация Автомобили Животные Спорт Путешествия Игры Юмор

Интересные видео

2025 Сериалы Трейлеры Новости Как сделать Видеоуроки Diy своими руками

Топ запросов

смотреть а4 schoolboy runaway турецкий сериал смотреть мультфильмы эдисон
dTub
Скачать

xqc clips that cured me

Автор: Bozzeh

Загружено: 2021-03-21

Просмотров: 683102

Описание:

xQc is officially juicing it.
If you enjoyed this compilation, don't forget to like, subscribe & comment for more xQc content just like this!

*********************************************************
The best protein and gymwear: https://tidd.ly/3C97dHW
If you are the original owner of the content viewed in this video, please contact me at [email protected]

Please find xQc's socials here:
Twitch:   / xqcow​  
YouTube: https://www.youtube.com/channel/UCmDT...
Twitter:   / xqc​  
Instagram:   / xqcow1​  
Reddit:   / ​  
Discord:   / discord  
Merch: https://metathreads.com/collections/xqc

You can also find my socials here:
  / bozzeh10  
2nd Channel:    / @xqcpepegaclips9610  

Submit your clips or suggest your video titles here: https://forms.gle/323aLMFV2haoTTTJA

Clip links in order as seen in the video:
*********************************************************
00:00 -   / kawaiiabstemiousbasenjisaltbae  
00:20 -   / importantcovertfoxthething-vwqk7hgpqakpiwsm  
00:34 -   / saltydirtydovevohiyo-z5q4m3m5unseevbq  
00:42 -   / nimbledeterminedwolfsmoocherz-m34lksybbddq...  
01:01 -   / relievedoilyrabbittinyface-9dibdkxjoj-3qvqt  
01:16 -   / confidentpoliteyampartytime-cm8qvhoqcftesft6  
01:27 -   / brightoilyfishlitfam-yg34-uxwpnvz6p-l  
02:15 -   / piercingspineynigiribleedpurple-n-_298n_dw...  
02:29 -   / trustworthyobesedillbrokeback-nnrj5rhfofdds5  
02:47 -   / lightscrumptiouseggplantsobayed-27ui3goe1t...  
03:05 -   / nastyencouragingokapiblargnaut-mpvm9rrjf1i...  
03:14 -   / littleneighborlyyakinikukappa-2zxie_9okcs1...  
03:37 -   / fancyroughflamingobrokeback-mvjtmloksfcqtf4u  
03:59 -   / funnypeacefulbaconralpherz-gjlwlshqdfig1b1a  
04:17 -   / livelycoweringdiscfunrun-yecl-vwwco_n4rod  
04:38 -   / boringpatientmeerkatsoonerlater  
04:49 -   / boringfitspindletbtacoright-cxcc92-u4rrd0x8  
05:01 -   / interestingtenuoushippoohmydog-yn76z4vbetf...  
05:22 -   / littlepolitewheelpunchtrees-kqbernc5ifticaha  
05:46 -   / coldgentleburritopartytime-gkb3b-t7plst8anz  
06:40 -   / clumsydaintysharktrihard-s6zhiakm7btyxa44  
06:50 -   / frigidimpartialgirafferaccattack-qrkixmihr...  
07:23 -   / refinedkathishgaurdogface-ibtwajvwb4fvgjm3  
07:40 -   / arborealcrazytapirpanicvis-tlrjuanzoyot0ast  
07:47 -   / badzanychinchillam4xheh-dp0urvv47r8uxrvv  
07:59 -   / opengenerouspeanutfungineer-wnayc9a2vmnge-ay  
08:33 (last clip) -   / zealouscautiousfloofcopythis-bz8jtz9b0wv7ljjo  
*********************************************************
#Bozzeh

xQcOW? xQc (Felix Lengyel) is the gaming golem on the Twitch.tv platform. The OW is short to Overwatch. He amasses a following of 7.8M+ on his twitch profile, and his viewership and interactions/impressions reach upto thousands, even millions across all of his social platforms. All his social links can be found in the links section to view xQc's profiles. xQc is the MEGALUL warlock we all know, my favorite label is EL GOBLINO, but other nicknames may be Mr.Cow, The Fart of Twitch, X, xQ Cow, PVC, QVC, HDTV, LMG, PVP etc...He also refers to himself as the gaming golem, warlord of the gaming scene. His early mark on Twitch was due to his popularity on Overwatch, he is a top500 tank main, but he also competed in the Overwatch League for Dallas Fuel and in the Overwatch World Cup with Canada. These days, xQc finds his rhythm by entertaining through variety of games, including Minecraft, Overwatch, Chess, Fortnite, Valorant, CSGO, Simulators, Horror Games just to name a few!

xqc clips that cured me

Поделиться в:

Доступные форматы для скачивания:

Скачать видео mp4

  • Информация по загрузке:

Скачать аудио mp3

Похожие видео

xqc clips that cured my anxiety

xqc clips that cured my anxiety

xqc clips that make you book book book

xqc clips that make you book book book

10 Minutes of xQc Being Unhinged 💀🔥 – Funniest Twitch Clips (2025 Compilation)

10 Minutes of xQc Being Unhinged 💀🔥 – Funniest Twitch Clips (2025 Compilation)

XQC ULTIMATE PEPEGA MOMENTS COMPILATION #1 | xQcOW

XQC ULTIMATE PEPEGA MOMENTS COMPILATION #1 | xQcOW

xqc clips i think about while i sleep

xqc clips i think about while i sleep

clips that made xQc famous 6

clips that made xQc famous 6

xqc clips i watch at work

xqc clips i watch at work

xqc clips that make you go

xqc clips that make you go

Twitch Streamers Getting Trolled by Media Share Donations

Twitch Streamers Getting Trolled by Media Share Donations

xQc CAN'T STOP LAUGHING | XQC LAUGHING hysterically for 1 hour -Funniest clips and react andy

xQc CAN'T STOP LAUGHING | XQC LAUGHING hysterically for 1 hour -Funniest clips and react andy

xqc clips but el goblino loses his mind

xqc clips but el goblino loses his mind

xQc Getting Scared for 11 Minutes

xQc Getting Scared for 11 Minutes

xqc clips you need to show on your first date

xqc clips you need to show on your first date

клипы xqc, которые бы выиграли мастершеф

клипы xqc, которые бы выиграли мастершеф

xqc clips that are 90 degrees old

xqc clips that are 90 degrees old

Ultimate Twitch Voice Crack Compilation

Ultimate Twitch Voice Crack Compilation

clips that made xQc famous 5

clips that made xQc famous 5

xqc clips that make your schnozer grow bigger

xqc clips that make your schnozer grow bigger

xqc clips that stunlock you

xqc clips that stunlock you

xqc clips guaranteed to make you laugh

xqc clips guaranteed to make you laugh

© 2025 dtub. Все права защищены.



  • Контакты
  • О нас
  • Политика конфиденциальности



Контакты для правообладателей: [email protected]